CCL28_MOUSE   Q9JIL2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JIL2

Recommended name:C-C motif chemokine 28

EC number:

Alternative names:(Small-inducible cytokine A28)

Cleaved into:

GeneID:56838

Gene names  (primary ):Ccl28

Gene names  (synonym ):Scya28

Gene names  (ORF ):

Length:130

Mass:14570

Sequence:MQQAGLTLMAVAVCVAFQTSEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR

Tissue specificity:Mainly expressed in testis, epithelial cells of normal colon, kidney, Peyer patches, lymph nodes. Also found in lower levels in brain, spleen and lung.

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp