SPR2A_MOUSE   Q9CQK8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQK8

Recommended name:Small proline-rich protein 2A1

EC number:

Alternative names:(small proline-rich protein 2A)

Cleaved into:

GeneID:100042514

Gene names  (primary ):Sprr2a1

Gene names  (synonym ):Sprr2a

Gene names  (ORF ):

Length:83

Mass:9408

Sequence:MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cornifin (SPRR) family


   💬 WhatsApp