RB33A_MOUSE P97950
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97950
Recommended name：Ras-related protein Rab-33A
EC number：
Alternative names：(Small GTP-binding protein S10)
Cleaved into：
GeneID：19337
Gene names (primary )：Rab33a
Gene names (synonym )：Rabs10
Gene names (ORF )：
Length：237
Mass：26541
Sequence：MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFSQEANGKASCPC
Tissue specificity：Expressed predominantly in brain. Weak expression in ovary.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family