SP30L_MOUSE   Q5SQF8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5SQF8

Recommended name:Histone deacetylase complex subunit SAP30L

EC number:

Alternative names:(Sin3 corepressor complex subunit SAP30L) (Sin3-associated protein p30-like)

Cleaved into:

GeneID:50724

Gene names  (primary ):Sap30l

Gene names  (synonym ):

Gene names  (ORF ):

Length:182

Mass:20745

Sequence:MNGFSTEEDSREGPPAAPAAAPGYGQSCCLIADGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKASDDGGDSPEHDADIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNRSRLDQKSEGSKQLE

Tissue specificity:

Induction:

Developmental stage:

Protein families:SAP30 family


   💬 WhatsApp