SGMR1_MOUSE   O55242


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55242

Recommended name:Sigma non-opioid intracellular receptor 1

EC number:

Alternative names:(Sigma 1-type opioid receptor) (Sigma1-receptor) (Sigma1R)

Cleaved into:

GeneID:18391

Gene names  (primary ):Sigmar1

Gene names  (synonym ):Oprs1

Gene names  (ORF ):

Length:223

Mass:25250

Sequence:MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS

Tissue specificity:Widely expressed with higher expression in liver, brain, kidney and thymus. Expressed throughout the brain with higher expression within cerebral cortex, hippocampus and cerebellum. Within the hippocampus expressed in cornu ammonis pyramidal neurons, the granular cells of the dentate gyrus as well as interneurons. Within the cerebellum, expressed in Purkinje cell bodies (PubMed:11207432, PubMed:11476895, PubMed:11687279, PubMed:9603192). Highly expressed in the brainstem and motor neurons of the spinal cord (PubMed:20167253). Expressed by neural retina, retinal pigment epithelial cells and lens (PubMed:11207432, PubMed:11476895, PubMed:11687279, PubMed:9603192). {ECO:0000269|PubMed:11207432, ECO:0000269|PubMed:11476895, ECO:0000269|PubMed:11687279, ECO:0000269|PubMed:20167253, ECO:0000269|PubMed:9603192}.

Induction:

Developmental stage:

Protein families:ERG2 family


   💬 WhatsApp