RHOG_MOUSE   P84096


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P84096

Recommended name:Rho-related GTP-binding protein RhoG

EC number:

Alternative names:(Sid 10750)

Cleaved into:

GeneID:56212

Gene names  (primary ):Rhog

Gene names  (synonym ):Arhg Sid10750

Gene names  (ORF ):

Length:191

Mass:21309

Sequence:MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp