CD33_MOUSE Q63994
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63994
Recommended name：Myeloid cell surface antigen CD33
EC number：
Alternative names：(Sialic acid-binding Ig-like lectin 3) (Siglec-3) (CD antigen CD33)
Cleaved into：
GeneID：12489
Gene names (primary )：Cd33
Gene names (synonym )：Siglec3
Gene names (ORF )：
Length：403
Mass：44824
Sequence：MLWPLPLFLLCAGSLAQDLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRELVLVAVGEATVKLLILGLCLVFLIVMFCRRKTTKLSVHMGCENPIKRQEAITSYNHCLSPTASDAVTPGCSIHRLISRTPRCTAILRIQDPYRRTHLRNRAVSTLRFPWISWEGSLRSTQRSKCTKLCSPVKNLCPLWLPVDNSCIPLIPEWVMLLCVSLTLS
Tissue specificity：Expressed on myeloid precursors in the bone marrow. In the peripheral blood, mostly expressed on granulocytes. {ECO:0000269|PubMed:12773563}.
Induction：
Developmental stage：
Protein families：Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family