SHRPN_MOUSE   Q91WA6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WA6

Recommended name:Sharpin

EC number:

Alternative names:(Shank-associated RH domain-interacting protein) (Shank-interacting protein-like 1) (mSIPL1)

Cleaved into:

GeneID:106025

Gene names  (primary ):Sharpin

Gene names  (synonym ):Cpdm Sipl1

Gene names  (ORF ):

Length:380

Mass:39852

Sequence:MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST

Tissue specificity:Highly expressed in thymus and spleen. Present at high level in splenic B- and T-cells (at protein level). {ECO:0000269|PubMed:21455180}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp