SFT2B_MOUSE   Q8VD57


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VD57

Recommended name:Vesicle transport protein SFT2B

EC number:

Alternative names:(SFT2 domain-containing protein 2)

Cleaved into:

GeneID:108735

Gene names  (primary ):Sft2d2

Gene names  (synonym ):

Gene names  (ORF ):

Length:159

Mass:17499

Sequence:MDKLKKVLSGQDTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRKGLGLFAVFYTLGNIMSIGSTVFLMGPLKQLKRMFEPTRLIATILVLLCFALTLCSAFLWNKGLALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCLA

Tissue specificity:

Induction:

Developmental stage:

Protein families:SFT2 family


   💬 WhatsApp