SF3A2_MOUSE Q62203
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62203
Recommended name：Splicing factor 3A subunit 2
EC number：
Alternative names：(SF3a66) (Spliceosome-associated protein 62) (SAP 62)
Cleaved into：
GeneID：
Gene names (primary )：Sf3a2
Gene names (synonym )：Sap62
Gene names (ORF )：
Length：475
Mass：49911
Sequence：MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEQVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPDALPPPPPGGLPLPPMPPTGPAPSGPPGPPQMPPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPPAPAVHPQAPGVHPPAPGIHPQAPGVHPQPPPGVHPAAPGVHPQPPGVHPSNPGVHPAPMPPMLRPPLPSDGPGNMPPPPPGN
Tissue specificity：Found in all tissues examined.
Induction：
Developmental stage：
Protein families：SF3A2 family