TM11E_MOUSE   Q5S248


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5S248

Recommended name:Transmembrane protease serine 11E

EC number:EC 3.4.21.-

Alternative names:(Serine protease DESC1)

Cleaved into:Transmembrane protease serine 11E non-catalytic chain; Transmembrane protease serine 11E catalytic chain

GeneID:243084

Gene names  (primary ):Tmprss11e

Gene names  (synonym ):Desc1

Gene names  (ORF ):

Length:423

Mass:48065

Sequence:MYRSCVVRARKRTCVEPWVIGIISFLSLIVLAVCIGLTVHYVRYNHRRTYNYYSTLSFTSDKLYSEFGREASKNFTEMSQRIETMVKHAFHKSPLRGQLVKAHIIKFSKEDDGVLAHMLLIFRIRSTEDPETVHKIIEYVLHEKLKYATGPPNVDPESVKIKKINKTESDNYFNHCCGTRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLRWDGSHRCGATLINNTWLVTAAHCFRTHKDPSRWSATFGATLQPRKLTTGIRRIIVHEKYKYPSHDYDIALAELSKPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTCNQPQSYNGAITPRMLCAGFLKGEKDACQGDSGGPLVTADVRDIWYLAGVVSWGDECGQPNKPGVYTRVTAFRHWIASNTGI

Tissue specificity:Expressed in epidermal, oral and male reproductive tissues. {ECO:0000269|PubMed:15328353}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family


   💬 WhatsApp