DWORF_MOUSE P0DN83
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DN83
Recommended name:Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF
EC number:
Alternative names:(SERCA regulator DWORF) (Dwarf open reading frame) (DWORF) (Small transmembrane regulator of ion transport 1)
Cleaved into:
GeneID:
Gene names (primary ):Strit1
Gene names (synonym ):
Gene names (ORF ):
Length:34
Mass:3815
Sequence:MAEKESTSPHLIVPILLLVGWIVGCIIVIYIVFF
Tissue specificity:Highly expressed in heart (at protein level). Detected in heart and soleus, a postural muscle group of the hindlimb containing the highest enrichment of slow-twitch muscle fibers. Also expressed in diaphragm, which contains some slow-twitch fibers. Not detected in the quadriceps, a fast-twitch muscle group, or in cardiac atrial muscle. Not expressed in the prenatal heart but gradually increases in abundance postnatally. {ECO:0000269|PubMed:26816378}.
Induction:
Developmental stage:
Protein families: