SMR2C_MOUSE   O35985


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35985

Recommended name:Submaxillary gland androgen-regulated protein 2, isoform gamma

EC number:

Alternative names:(Salivary protein MSG2, isoform gamma)

Cleaved into:

GeneID:20600

Gene names  (primary ):Smr2

Gene names  (synonym ):Msg2 Vcs2

Gene names  (ORF ):

Length:143

Mass:16158

Sequence:MKALYMVFVLWVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSHFYPQPDPNRVQISQPDNIPIFMFEQPHSLNICVPPPPLYLGEEFEKLPPNTHIPYILIRPDIEPPSKYIQPVPRKKSNATPAANNFITTATAPNSTDSF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp