SMR2E_MOUSE   O35961


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35961

Recommended name:Submaxillary gland androgen-regulated protein 2, isoform epsilon

EC number:

Alternative names:(Salivary protein MSG2, isoform epsilon)

Cleaved into:

GeneID:

Gene names  (primary ):Smr2

Gene names  (synonym ):Msg2 Vcs2

Gene names  (ORF ):

Length:40

Mass:4678

Sequence:MKALYMVFVLWVLIGCFLRCKERMGSEEKQAQEDPGDQDL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp