SMR3A_MOUSE   Q61900


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61900

Recommended name:Submaxillary gland androgen-regulated protein 3A

EC number:

Alternative names:(Salivary protein MSG1) (Submaxillary gland androgen-regulated protein 1)

Cleaved into:

GeneID:20599

Gene names  (primary ):Smr3a

Gene names  (synonym ):Msg1 Smr1

Gene names  (ORF ):

Length:147

Mass:15544

Sequence:MKPLNLVLGLCILVGCFLSCECHRGPRRHDPRGPFPPPPPPHGPGIGRPHPPPFGPGIGRPPPPPFGPGIGRPPPPPPCPPVPPHPRPPSNPSPPPTPSIPPTGPPTTVQATTMPAASISITTPTARDSTDIFWRLWELINSLLQQE

Tissue specificity:Secreted into saliva by submaxillary gland.

Induction:

Developmental stage:

Protein families:PROL1/PROL3 family


   💬 WhatsApp