S100B_MOUSE P50114
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50114
Recommended name：Protein S100-B
EC number：
Alternative names：(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)
Cleaved into：
GeneID：20203
Gene names (primary )：S100b
Gene names (synonym )：
Gene names (ORF )：
Length：92
Mass：10728
Sequence：MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
Tissue specificity：Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
Induction：
Developmental stage：
Protein families：S-100 family