OPSB_MOUSE P51491
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51491
Recommended name：Short-wave-sensitive opsin 1
EC number：
Alternative names：(S opsin) (Blue cone photoreceptor pigment) (Blue-sensitive opsin) (BOP) (Short wavelength-sensitive cone opsin)
Cleaved into：
GeneID：12057
Gene names (primary )：Opn1sw
Gene names (synonym )：Bcp
Gene names (ORF )：
Length：346
Mass：38922
Sequence：MSGEDDFYLFQNISSVGPWDGPQYHLAPVWAFRLQAAFMGFVFFVGTPLNAIVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMADESDVSGSQKTEVSTVSSSKVGPH
Tissue specificity：Expressed in the inner and outer segments of cone photoreceptor cells in the retina (at protein level). {ECO:0000269|PubMed:11055434, ECO:0000269|PubMed:21219924, ECO:0000269|PubMed:25416279}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Opsin subfamily