RRFM_MOUSE   Q9D6S7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D6S7

Recommended name:Ribosome-recycling factor, mitochondrial

EC number:

Alternative names:(RRF) (Ribosome-releasing factor, mitochondrial)

Cleaved into:

GeneID:67871

Gene names  (primary ):Mrrf

Gene names  (synonym ):

Gene names  (ORF ):

Length:262

Mass:29051

Sequence:MASGIRCFRLLHPAFRSYHAALTRPVSEVSMKTVSGRQHGHRQYSAYPAVPVRHFATKKAKAKGKGQPQARVTVNRALVEDIISLEEVDEDMKSVVEALKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRKVRTNAMNKLKKSKDKTSEDTIRLIEKQISQMADDTVAELDQHLAAKTKELLG

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRF family


   💬 WhatsApp