ROM1_MOUSE   P32958


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P32958

Recommended name:Rod outer segment membrane protein 1

EC number:

Alternative names:(ROSP1)

Cleaved into:

GeneID:19881

Gene names  (primary ):Rom1

Gene names  (synonym ):Rom-1

Gene names  (ORF ):

Length:351

Mass:37265

Sequence:MAPVLPVVLPLQPRIRLAQGIWLLSWLLALVGGLTLLCSGHLLVQLGHLGTFLAPSCSFPALPQTALAAGTVALGTGLGGAGASRASLDAAQYPPWRGVLTPLLAVGTAAGGGLLTLALGLALALPVSLNQGLEEGLEAALAHYKDTEVPGRCQAKRLMDELQLRYHCCGRHGYKDWFGVQWVSNRYLDPSDQDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFDPRQPNLNLWAQGCHEVLLEHLQGLSGTLGSILAVTLLLQILVLLGLRYLQTALEGLGGVIDGEGEAQGYLFPGGLKDILKTAWLQGGLAHKPAPEEAPPDEEPPKEVLAEA

Tissue specificity:Expressed in the retina (at protein level). {ECO:0000269|PubMed:26406599}.

Induction:

Developmental stage:

Protein families:PRPH2/ROM1 family


   💬 WhatsApp