ROMO1_MOUSE   P60603


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60603

Recommended name:Reactive oxygen species modulator 1

EC number:

Alternative names:(ROS modulator 1) (Protein MGR2 homolog)

Cleaved into:

GeneID:67067

Gene names  (primary ):Romo1

Gene names  (synonym ):

Gene names  (ORF ):

Length:79

Mass:8183

Sequence:MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Tissue specificity:Detected in brain, liver and kidney. {ECO:0000269|PubMed:16842742}.

Induction:

Developmental stage:

Protein families:MGR2 family


   💬 WhatsApp