NXNL2_MOUSE Q9D531
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D531
Recommended name：Nucleoredoxin-like protein 2
EC number：
Alternative names：(Rod-derived cone viability factor 2) (RdCVF2)
Cleaved into：
GeneID：75124
Gene names (primary )：Nxnl2
Gene names (synonym )：
Gene names (ORF )：
Length：156
Mass：17620
Sequence：MVDVLGGRRLVTREGTVVEAEVALQNKVVALYFAAGRCSPSRDFTPLLCDFYTELVSEARRPAPFEVVFVSADGSAEEMLDFMRELHGSWLALPFHDPYRHELKKRYEITAIPKLVVIKQNGAVITNKGRKQIRERGLACFQNWVEAADVFQNFSG
Tissue specificity：Both isoforms are expressed in retina, in the photoreceptor layer, and throughout the olfactory sensory neuron layer of the nasal epithelium, in neurons. Also expressed at low levels in brain and testis. {ECO:0000269|PubMed:17764561, ECO:0000269|PubMed:22343139}.
Induction：
Developmental stage：
Protein families：Nucleoredoxin family