RNH2C_MOUSE   Q9CQ18


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ18

Recommended name:Ribonuclease H2 subunit C

EC number:

Alternative names:(RNase H2 subunit C) (Ribonuclease HI subunit C)

Cleaved into:

GeneID:68209

Gene names  (primary ):Rnaseh2c

Gene names  (synonym ):Ayp1

Gene names  (ORF ):

Length:166

Mass:17823

Sequence:MKNPEEAADGKQRIHLRPGSLRGAAPAKLHLLPCDVLVSRPAPVDRFFTPAVRHDADGLQASFRGRGLRGEEVAVPPGFAGFVMVTEEKGEGLIGKLNFSGDAEDKADEAQEPLERDFDRLIGATGSFSHFTLWGLETVPGPDAKVHRALGWPSLAAAIHAQVPED

Tissue specificity:

Induction:

Developmental stage:

Protein families:RNase H2 subunit C family


   💬 WhatsApp