RBM38_MOUSE   Q62176


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62176

Recommended name:RNA-binding protein 38

EC number:

Alternative names:(RNA-binding motif protein 38) (RNA-binding region-containing protein 1) (ssDNA-binding protein SEB4)

Cleaved into:

GeneID:56190

Gene names  (primary ):Rbm38

Gene names  (synonym ):Rnpc1 Seb4 Seb4l

Gene names  (ORF ):

Length:237

Mass:25364

Sequence:MLLQPACSPSVFPRPSAAPSAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAADRACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAVGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPATPVPSLSSPYLEYTPASPAYAQYPPATYDQYPYAASPAAATSFVGYGYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ

Tissue specificity:Expressed in cardiac and skeletal muscle tissues. {ECO:0000269|PubMed:19817877}.

Induction:

Developmental stage:

Protein families:RBM38 family


   💬 WhatsApp