RPAB5_MOUSE P62876
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62876
Recommended name:DNA-directed RNA polymerases I, II, and III subunit RPABC5
EC number:
Alternative names:(RNA polymerases I, II, and III subunit ABC5) (DNA-directed RNA polymerase III subunit L) (RPB10 homolog)
Cleaved into:
GeneID:66491
Gene names (primary ):Polr2l
Gene names (synonym ):
Gene names (ORF ):
Length:67
Mass:7645
Sequence:MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Tissue specificity:
Induction:
Developmental stage:
Protein families:Archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family