RPAB4_MOUSE Q63871
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63871
Recommended name：DNA-directed RNA polymerases I, II, and III subunit RPABC4
EC number：
Alternative names：(RNA polymerases I, II, and III subunit ABC4) (DNA-directed RNA polymerase II subunit K) (Metallothionein-I gene transcription activator) (RPB10alpha)
Cleaved into：
GeneID：17749
Gene names (primary )：Polr2k
Gene names (synonym )：Mt1a
Gene names (ORF )：
Length：58
Mass：6974
Sequence：MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Tissue specificity：
Induction：
Developmental stage：
Protein families：Archaeal RpoP/eukaryotic RPC10 RNA polymerase subunit family