RPAB3_MOUSE Q923G2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923G2
Recommended name：DNA-directed RNA polymerases I, II, and III subunit RPABC3
EC number：
Alternative names：(RNA polymerases I, II, and III subunit ABC3) (DNA-directed RNA polymerase II subunit H) (RPB17) (RPB8 homolog)
Cleaved into：
GeneID：245841
Gene names (primary )：Polr2h
Gene names (synonym )：
Gene names (ORF )：
Length：150
Mass：17143
Sequence：MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic RPB8 RNA polymerase subunit family