RPAB1_MOUSE Q80UW8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80UW8
Recommended name：DNA-directed RNA polymerases I, II, and III subunit RPABC1
EC number：
Alternative names：(RNA polymerases I, II, and III subunit ABC1) (DNA-directed RNA polymerase II subunit E) (RPB5 homolog)
Cleaved into：
GeneID：66420
Gene names (primary )：Polr2e
Gene names (synonym )：
Gene names (ORF )：
Length：210
Mass：24570
Sequence：MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：Archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family