RPC9_MOUSE O35427
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35427
Recommended name：DNA-directed RNA polymerase III subunit RPC9
EC number：
Alternative names：(RNA polymerase III subunit C9) (Calcitonin gene-related peptide-receptor component protein) (CGRP-RCP) (CGRP-receptor component protein) (CGRPRCP)
Cleaved into：
GeneID：12909
Gene names (primary )：Crcp
Gene names (synonym )：
Gene names (ORF )：
Length：148
Mass：16683
Sequence：MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCRNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGPEDEQSKSTSNDVAMEEEEPA
Tissue specificity：Ubiquitous. Most prevalent in testis. {ECO:0000269|PubMed:10067875}.
Induction：
Developmental stage：
Protein families：Eukaryotic RPC9 RNA polymerase subunit family