RN185_MOUSE   Q91YT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91YT2

Recommended name:E3 ubiquitin-protein ligase RNF185

EC number:EC 2.3.2.27

Alternative names:(RING finger protein 185) (RING-type E3 ubiquitin transferase RNF185)

Cleaved into:

GeneID:193670

Gene names  (primary ):Rnf185

Gene names  (synonym ):

Gene names  (ORF ):

Length:192

Mass:20520

Sequence:MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA

Tissue specificity:Ubiquitously expressed with high expression in testis. {ECO:0000269|PubMed:27485036}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp