PCGF5_MOUSE   Q3UK78


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UK78

Recommended name:Polycomb group RING finger protein 5

EC number:

Alternative names:(RING finger protein 159)

Cleaved into:

GeneID:76073

Gene names  (primary ):Pcgf5

Gene names  (synonym ):Rnf159

Gene names  (ORF ):

Length:256

Mass:29657

Sequence:MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELQRELEFWKKNKPQENGQDDISKVDKSKADEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENLCCLNCSASQVCSQDGTLYQSYPMVLQYRPRIDFG

Tissue specificity:Detected in hematopoietic stem cells and multipotent progenitor cells. {ECO:0000269|PubMed:27136092}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp