R144A_MOUSE Q925F3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925F3
Recommended name：E3 ubiquitin-protein ligase RNF144A
EC number：EC 2.3.2.31
Alternative names：(RING finger protein 144A) (UbcM4-interacting protein 4) (Ubiquitin-conjugating enzyme 7-interacting protein 4)
Cleaved into：
GeneID：108089
Gene names (primary )：Rnf144a
Gene names (synonym )：Kiaa0161 Rnf144 Ubce7ip4 Uip4
Gene names (ORF )：
Length：292
Mass：32845
Sequence：MTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPITFLPGETSSAFKMEEGDAPIKRCPKCRVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Tissue specificity：
Induction：
Developmental stage：
Protein families：RBR family, RNF144 subfamily