RN114_MOUSE   Q9ET26


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ET26

Recommended name:E3 ubiquitin-protein ligase RNF114

EC number:EC 2.3.2.27

Alternative names:(RING finger protein 114) (RING-type E3 ubiquitin transferase RNF114) (Zinc finger protein 228) (Zinc finger protein 313)

Cleaved into:

GeneID:81018

Gene names  (primary ):Rnf114

Gene names  (synonym ):Zfp228 Zfp313 Znf228 Znf313

Gene names  (ORF ):

Length:229

Mass:25745

Sequence:MAAAQPESRDGAAQSAKPASETDPLSRFTCPVCLEVFEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAVELERQIESIETSCHGCRKNFILSKIRAHVTSCSKYQNYIMEGVKATTKDASLQPRNIPNRYTFPCPYCPEKNFDQEGLVEHCKLTHSTDTKSVVCPICASMPWGDPSYRSANFMEHIQRRHRFSYDTFVDYDVDEDDMINQVLQRSIIDQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp