TRI59_MOUSE   Q922Y2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q922Y2

Recommended name:Tripartite motif-containing protein 59

EC number:

Alternative names:(RING finger protein 1)

Cleaved into:

GeneID:66949

Gene names  (primary ):Trim59

Gene names  (synonym ):Mrf1

Gene names  (ORF ):

Length:403

Mass:47238

Sequence:MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDITRLIEKLEEQKCHSEKIVQGDKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQIQGMKEIREQQLELMTITTSLQDESPLKFLEKIDEVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKAVIPEMRVSSKRTPCSWSDNDEKEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEITSICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR

Tissue specificity:Moderately expressed in the spleen, brain and heart and very highly expressed in the testis (PubMed:12095697). {ECO:0000269|PubMed:12095697}.

Induction:

Developmental stage:

Protein families:TRIM/RBCC family


   💬 WhatsApp