RRP15_MOUSE   Q9CYX7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CYX7

Recommended name:RRP15-like protein

EC number:

Alternative names:(Ribosomal RNA-processing protein 15)

Cleaved into:

GeneID:67223

Gene names  (primary ):Rrp15

Gene names  (synonym ):

Gene names  (ORF ):

Length:281

Mass:31058

Sequence:MAAAVQDSRVSPGEILKRSPKKKKKMKMVAKAAASKLEDEVKDSSDGEGSCDSEMDHSDDGAAEADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQERLEKRKQLDKKREWEMLCRVKPDVVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFISVLRGMDGTSRNSPAGKSPKARQTEVKSEESPGWKILRDDFMMGASMKDWDKESEGEEPAGGRAEAAASR

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRP15 family


   💬 WhatsApp