RHG24_MOUSE   Q8C4V1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C4V1

Recommended name:Rho GTPase-activating protein 24

EC number:

Alternative names:(Rho-type GTPase-activating protein 24)

Cleaved into:

GeneID:231532

Gene names  (primary ):Arhgap24

Gene names  (synonym ):

Gene names  (ORF ):

Length:747

Mass:84100

Sequence:MEERCESTESPQGQGRKNTKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLHGNKVIEHPCNEENPGKFLFDVVPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSKPQDGPNSNNNDGHKKATMGQLQNKENNNTKESPVRRCSWDKPESPQRSSVDNGSPTALSGSKTNSPRNSIHKLDISRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGVEKPQTTPNGSLQARRTSSLKSSGTKMGTHSVQNGTVRMGILNTDTLGNSLNGRSMSWLPNGYVTLRDNKQKEPAGESGQHNRLSTYDNVHQQFSSMSLDDKHSVDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFYVGNFEDPVLDGPPQDDLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGNTSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMLSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGDLTVEPRRSERGNTIWIQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp