RHOU_MOUSE   Q9EQT3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQT3

Recommended name:Rho-related GTP-binding protein RhoU

EC number:

Alternative names:(Rho GTPase-like protein ARHU) (Wnt-1 responsive Cdc42 homolog 1) (WRCH-1)

Cleaved into:

GeneID:69581

Gene names  (primary ):Rhou

Gene names  (synonym ):Arhu G28k Wrch1

Gene names  (ORF ):

Length:261

Mass:28354

Sequence:MAPQQGRPALPARCEPPAAPPVPPRRERGGRGARGPGVSGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPTSFQNVGEKWVPEIRRHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEVKAVSYIECSALTQKNLKEVFDAAIVAGIQHSDSQLQPKKSKSRTPDKVRDLSKSWWRKYCCLA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp