RGS17_MOUSE Q9QZB0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZB0
Recommended name:Regulator of G-protein signaling 17
EC number:
Alternative names:(RGS17) (Regulator of Gz-selective protein signaling 2)
Cleaved into:
GeneID:56533
Gene names (primary ):Rgs17
Gene names (synonym ):Rgsz2
Gene names (ORF ):
Length:210
Mass:24345
Sequence:MRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVINRSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES
Tissue specificity:Detected in brain (at protein level) (PubMed:15827571, PubMed:16900103). Highly expressed in the hypothalamus, periaqueductal gray matter, and pons-medulla. Lower levels in the thalamus, cortex and spinal cord. Weak expression in the striatum and cerebellum. {ECO:0000269|PubMed:15827571, ECO:0000269|PubMed:16900103}.
Induction:
Developmental stage:
Protein families: