U119A_MOUSE   Q9Z2R6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2R6

Recommended name:Protein unc-119 homolog A

EC number:

Alternative names:(Retinal protein 4) (mRG4)

Cleaved into:

GeneID:22248

Gene names  (primary ):Unc119

Gene names  (synonym ):Unc119h

Gene names  (ORF ):

Length:240

Mass:27010

Sequence:MKVKKGGGGTGSGAEPVPGASNRSAEPTREPGAEAESGSESEPEPGPGPRLGPLQGKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Tissue specificity:Localized in photoreceptor synapses in the outer plexiform layer of the retina. {ECO:0000269|PubMed:18296658}.

Induction:

Developmental stage:

Protein families:PDE6D/unc-119 family


   💬 WhatsApp