RGCC_MOUSE   Q9DBX1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DBX1

Recommended name:Regulator of cell cycle RGCC

EC number:

Alternative names:(Response gene to complement 32 protein) (RGC-32)

Cleaved into:

GeneID:66214

Gene names  (primary ):Rgcc

Gene names  (synonym ):Rgc32

Gene names  (ORF ):

Length:137

Mass:14717

Sequence:MKPPSAQSSPAAVAAAAPAMDSAAAADLTDVLCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSVYRDSFTFSDEKLNSPTNSSPALLPSAVTPRKAKLGDTKELEDFIADLDRTLASM

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp