RIC3_MOUSE Q8BPM6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BPM6
Recommended name：Protein RIC-3
EC number：
Alternative names：(Resistant to inhibitor of cholinesterase 3)
Cleaved into：
GeneID：320360
Gene names (primary )：Ric3
Gene names (synonym )：
Gene names (ORF )：
Length：367
Mass：40283
Sequence：MAYSTVQRVALASGLVLAVSLLLPKAFLSRGKRPEPPPGPEGKLDRFPPMMHHHSAPSDGQTPGARFQRSHLAEAFAKAKGAGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTAEDRNCSTAPPGNAHRKITNFELVQLQEKLKETEEAMEKLINRVGPNGESRAQAVTSDQEKRLLHQLREITRVMKEGKFIDTSPEKEAEEAPYMEDWEGYPEETYPIYDLSDGIKRRQETILVDYPDLKEPSAEEIAEQMGEIEEEGSERLSWDHLPTDPGAQKDNSVAPCDPKPESCSCCVHEEEDPAVLAENAGFSADGYSEQEEATKENLPQDFTNEGLGVSTDNAHVGGMLRKRNPQGFE
Tissue specificity：Expressed in brain, with highest levels in hippocampus, cerebellum and superior colliculus. {ECO:0000269|PubMed:12821669}.
Induction：
Developmental stage：
Protein families：Ric-3 family