SPE4A_MOUSE   Q5IBH6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5IBH6

Recommended name:Speedy protein E4A

EC number:

Alternative names:(Rapid inducer of G2/M progression in oocytes E4A) (RINGO E4A) (mSpy/Ringo E4A)

Cleaved into:

GeneID:74673

Gene names  (primary ):Spdye4a

Gene names  (synonym ):Spdyb

Gene names  (ORF ):

Length:268

Mass:30977

Sequence:MGEGTPGVDSARVQEEGGRDQSLGFVEGRIQVGRIVTAGQLSLCSEEQSPQPGITRPSPGVVVDGESSGLAEPRVEATPQPPSSIQKRKRDESLDSEDDLAELFEPDPQPVWSVEMLCGLRMRLKRRRVSTVRPEHHKVFTKLLEDPVVKKFLTWDKMLRVSDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDMEEDNQAPKQDIFYFLYGKSYAQRPMFHKLRFQFIRSMGWKIWVSREECEEIQAYNPDLWVWARDRTNLT

Tissue specificity:Testis-specific. {ECO:0000269|PubMed:15611625}.

Induction:

Developmental stage:

Protein families:Speedy/Ringo family


   💬 WhatsApp