RABX5_MOUSE Q9JM13
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM13
Recommended name:Rab5 GDP/GTP exchange factor
EC number:
Alternative names:(Rabex-5)
Cleaved into:
GeneID:56715
Gene names (primary ):Rabgef1
Gene names (synonym ):Rabex5
Gene names (ORF ):
Length:491
Mass:56869
Sequence:MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQRQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRAGSKKEIQEAKAPSPSINRQTSIETDRVTKEFIDFLKTFHKTGQEVYKQTKMFLEAMPYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPEKVEKIMDQIEKHIMTRLYKFVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESESWPPEACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG
Tissue specificity:Expressed in the white matter tracts of the cerebellum, the fimbria hippocampi and the corpus callosum. {ECO:0000269|PubMed:10926822}.
Induction:
Developmental stage:
Protein families: