RAB24_MOUSE P35290
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35290
Recommended name:Ras-related protein Rab-24
EC number:
Alternative names:(Rab-16)
Cleaved into:
GeneID:19336
Gene names (primary ):Rab24
Gene names (synonym ):
Gene names (ORF ):
Length:203
Mass:23144
Sequence:MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMCVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLSQKANPYFYSCCHH
Tissue specificity:Widely expressed, with highest expression in brain. {ECO:0000269|PubMed:8126105}.
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Rab family