RAB24_MOUSE   P35290


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35290

Recommended name:Ras-related protein Rab-24

EC number:

Alternative names:(Rab-16)

Cleaved into:

GeneID:19336

Gene names  (primary ):Rab24

Gene names  (synonym ):

Gene names  (ORF ):

Length:203

Mass:23144

Sequence:MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMCVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLSQKANPYFYSCCHH

Tissue specificity:Widely expressed, with highest expression in brain. {ECO:0000269|PubMed:8126105}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp