RAB12_MOUSE P35283
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35283
Recommended name：Ras-related protein Rab-12
EC number：
Alternative names：(Rab-13)
Cleaved into：
GeneID：19328
Gene names (primary )：Rab12
Gene names (synonym )：
Gene names (ORF )：
Length：243
Mass：27329
Sequence：MDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDVLRNELSNSILSLQPEPEIPPELPPPRPHVRCC
Tissue specificity：Ubiquitously expressed. {ECO:0000269|PubMed:21718402}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family