ZPI_MOUSE Q8R121
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R121
Recommended name：Protein Z-dependent protease inhibitor
EC number：
Alternative names：(PZ-dependent protease inhibitor) (PZI) (Serpin A10)
Cleaved into：
GeneID：217847
Gene names (primary )：Serpina10
Gene names (synonym )：Zpi
Gene names (ORF )：
Length：448
Mass：51797
Sequence：MRVASSLFLPVLLTEVWLVTSFNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL
Tissue specificity：Detectable in liver, but not in heart, brain, spleen, lung, kidney, skeletal muscle or testes. {ECO:0000269|PubMed:11372680}.
Induction：
Developmental stage：
Protein families：Serpin family