IFT27_MOUSE Q9D0P8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D0P8
Recommended name：Intraflagellar transport protein 27 homolog
EC number：
Alternative names：(Putative GTP-binding protein RAY-like) (Rab-like protein 4)
Cleaved into：
GeneID：67042
Gene names (primary )：Ift27
Gene names (synonym )：Rabl4 Rayl
Gene names (ORF )：
Length：186
Mass：20814
Sequence：MVKLAAKCILAGDPAVGKTALVQMFRSDGTHFQKNYTLTTGVDLVVKTVPVLDTNDSVELFIFDSAGKELFSEMLDKLWENPNVLCLVYDVTNEQSFISCTKWLEKVRSQTSGISLPGVLVGTKTDLAGRQTVDSAQAQVWALSQGLEFFETSVKEMDNYEAPFHCLAKQFYQLYREKVDIFHTLV
Tissue specificity：Expressed predominantly in the testis (at protein level) (PubMed:28964737). Co-localizes with RABL2/RABL2A in the midpiece of elongated spermatids within the testis (at protein level). {ECO:0000269|PubMed:23055941, ECO:0000269|PubMed:28964737}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family