S36A2_MOUSE Q8BHK3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BHK3
Recommended name：Proton-coupled amino acid transporter 2
EC number：
Alternative names：(Proton/amino acid transporter 2) (Solute carrier family 36 member 2) (Tramdorin-1)
Cleaved into：
GeneID：246049
Gene names (primary )：Slc36a2
Gene names (synonym )：Pat2 Tramd1
Gene names (ORF )：
Length：478
Mass：52063
Sequence：MSVTKSARSPQVATPLNLDLPESAKKLQSQDPSPANGSSSESSKKTKGITGFQTLVHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGLIACHCMHILVRCAQRFCHRLNKPFMDYGDTVMHGLAFSPNAWLQNHAHWGRRVVSFFLIVTQLGFCCVYIVFLADNLKQVVEAVNSTTISCHKNETVVLTPTMDSRLYMLSFLPVLGLLVFVRNLRVLTIFSLLANISMLVSLVIIAQYIIQEIPDASQLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKDARGFPTILSLGMSIITTLYIAIGALGYLRFGDDIKASITLNLPNCWLYQSVKLLYVVGILCTYALQFYVPAEIIIPLAVSQVSKRWALPVDLSIRLALVCLTCMLAILIPRLDLVLSLVGSVSSSALALIIPPLLEVVTYYGEGISPLTVTKDALISILGFMGFVVGTYQALDELIKSGNSPALSNSTMFIQ
Tissue specificity：Expressed in spinal cord, brain, testis, lung, heart, colon, spleen, kidney and muscle. Found in neuronal cell bodies in the anterior horn, in spinal cord brain stem, cerebellum, hippocampus, hypothalamus, rhinencephalon, cerebral cortex, and olfactory bulb in the brain. Also expressed in bone and fat tissues. {ECO:0000269|PubMed:12809675, ECO:0000269|PubMed:14600155, ECO:0000269|PubMed:15058382}.
Induction：
Developmental stage：
Protein families：Amino acid/polyamine transporter 2 family