S36A1_MOUSE Q8K4D3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4D3
Recommended name：Proton-coupled amino acid transporter 1
EC number：
Alternative names：(Proton/amino acid transporter 1) (Solute carrier family 36 member 1)
Cleaved into：
GeneID：215335
Gene names (primary )：Slc36a1
Gene names (synonym )：Pat1
Gene names (ORF )：
Length：475
Mass：52466
Sequence：MSTQRLRNEDYHDYSSTDVSPEESPSEGLGSFSPGSYQRLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVMYGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYMLSFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPLILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFELMVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGEGISPLTVTKDALISILGFVGFVVGTYESLCELIQPSHSDSSTNSTSAFI
Tissue specificity：Highly expressed in small intestine, colon, kidney and brain. {ECO:0000269|PubMed:11959859}.
Induction：
Developmental stage：
Protein families：Amino acid/polyamine transporter 2 family