FA50A_MOUSE   Q9WV03


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WV03

Recommended name:Protein FAM50A

EC number:

Alternative names:(Protein XAP-5)

Cleaved into:

GeneID:108160

Gene names  (primary ):Fam50a

Gene names  (synonym ):D0HXS9928E Xap5

Gene names  (ORF ):

Length:339

Mass:40252

Sequence:MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQLKLEKLREKERKKEAKRKISSLSFTLEEEEEGVEEEEEMAMYEEELEREEITTKKKKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMKKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Tissue specificity:Widely expressed in embryonic and adult tissues.

Induction:

Developmental stage:

Protein families:FAM50 family


   💬 WhatsApp