TICN1_MOUSE   Q62288


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62288

Recommended name:Testican-1

EC number:

Alternative names:(Protein SPOCK)

Cleaved into:

GeneID:

Gene names  (primary ):Spock1

Gene names  (synonym ):Spock Ticn1

Gene names  (ORF ):

Length:442

Mass:49551

Sequence:MPAIAVLAAAAAAWCFLQVDSRHLDALAGGAALNNANFLDNDQWLSTVSQYDRDKYWNRFRDGIQDDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAHKHWLGPSNLVKCKPCPVAQSAMVCGSDGHTYTSKCKLEFHACSTGKSLNSLCDGPCPCLPEPEPLKPKAEKSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSDPAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEWCYCFQKPAGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGTVSCEEEQETSGDFGSGGSVVLLDDLEDERELGPKDKEGKLRVRTRAVREDDEDEDDDKEDEVGYIW

Tissue specificity:Predominantly expressed in the postsynaptic area of pyramidal neurons.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp